PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G204000.1
Common NamePHAVU_009G204000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Dof
Protein Properties Length: 319aa    MW: 34500.5 Da    PI: 6.98
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G204000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.8e-392181262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        +++ lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk+k+s+
  Phvul.009G204000.1 21 HHQPLKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSN 81
                        57899****************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-292079IPR003851Zinc finger, Dof-type
PfamPF027013.5E-332379IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.732579IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MQHIHSICGG DRRLRPHHHN HHQPLKCPRC DSLNTKFCYY NNYNLSQPRH FCKNCRRYWT  60
KGGVLRNVPV GGGCRKSKRS NKPKTTATNT NSDNNNPRSS SQIAPATAST TPSAAEAERN  120
SNSHSSSESS TLTVTEAMSA PTSNALSKNS LFLDSVRESK LFANADNPSL EGGGIFPEIG  180
SFTSLIASNN EALGFGFGNC SNNDTNSNSN NNILDTTPFR FGVAHPQGNN QAQVAPGGEQ  240
QQNHEEFGTA SFLDLTAPLE FSSLAQKSGE HGGGFGSLDW QPSGADQGLF DLPNTVDQPY  300
WSNSHWSDQD NPALFDLP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007138384.10.0hypothetical protein PHAVU_009G204000g
TrEMBLV7B0H70.0V7B0H7_PHAVU; Uncharacterized protein
STRINGGLYMA04G31690.11e-110(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.17e-54OBF binding protein 4